Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
Menu
0 items
Gaming Computers
4 product(s) found for "Gaming Computers"
RTX 3060 Starter Gamer
Gaming Computers
RTX 3060 Starter Gamer
Perfect start to PC gaming, with tried and true ryzen 5 performance, backed up with great components and the powerful RTX 3060
£679.99
Units in Stock: 10
£679.99
Details
Add To Cart
Perfect start to PC gaming, with tried and true ryzen 5 performance, backed up with great components and the powerful RTX 3060
RTX 4060 Gamer
Gaming Computers
RTX 4060 Gamer
Perfect start to PC gaming, with tried and true ryzen 5 performance, backed up with great components and the powerful RTX 4060
£769.99
Units in Stock: 10
£769.99
Details
Add To Cart
Perfect start to PC gaming, with tried and true ryzen 5 performance, backed up with great components and the powerful RTX 4060
Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i